PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.09G032700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family LBD
Protein Properties Length: 117aa    MW: 13138.2 Da    PI: 7.9329
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.09G032700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260126.31.5e-3951041100
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 
                          +CaaCk+lrr+C+ dC+++pyfp+++p++f +vhk++Gasnv k+l++lp++ r  a+++l+yeA++r++dPvyG+vg+i+ l qq++++
  Manes.09G032700.1.p   5 RCAACKYLRRRCPLDCIFSPYFPSNDPERFSCVHKIYGASNVGKMLQQLPDHLRAPAADCLCYEARCRIQDPVYGCVGIISLLDQQIQTA 94 
                          6***************************************************************************************** PP

               DUF260  91 kaelallkee 100
                          +++la++k+e
  Manes.09G032700.1.p  95 ENQLAETKAE 104
                          *****99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.0374105IPR004883Lateral organ boundaries, LOB
PfamPF031954.0E-395102IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 117 aa     Download sequence    Send to blast
MIYGRCAACK YLRRRCPLDC IFSPYFPSND PERFSCVHKI YGASNVGKML QQLPDHLRAP  60
AADCLCYEAR CRIQDPVYGC VGIISLLDQQ IQTAENQLAE TKAEIAVLAM HNNFHK*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002530717.11e-61PREDICTED: LOB domain-containing protein 24
SwissprotP594671e-55LBD23_ARATH; LOB domain-containing protein 23
SwissprotP594681e-55LBD24_ARATH; LOB domain-containing protein 24
TrEMBLB9SXJ81e-61B9SXJ8_RICCO; LOB domain-containing protein, putative
STRINGPOPTR_0012s13910.18e-59(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF36973066
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26660.16e-57LOB domain-containing protein 24